Principal Process EngineerOur EPCM Client based in the Gauteng region is looking for a Principal Process Engineer.Responsibilities:Play a key role in providing technically sound process engineering deliverables within specified time and budget constr...

No Sweat Work Media is looking for a talented remote Freelance Brand Identity & Website Designer to help build and refine a personal brand and online portfolio. This position offers a long-term collaborative opportunity for creative individuals who e...

Aramco energizes the world economy.Aramco occupies a special position in the global energy industry. We are one of the world’s largest producers of hydrocarbon energy and chemicals, with among the lowest Upstream carbon intensities of any major pro...

Let\'s Write Africa\'s Story Together!Old Mutual is a firm believer in the African opportunity and our diverse talent reflects this.We are looking for self-motivated and dynamic individuals who have a passionate entrepreneurial spirit to join one of ...

A dynamic company in South Africa is looking for an Executive Assistant to support its Directors with various administrative tasks. Responsibilities include managing calendars, scheduling meetings, making travel arrangements, and ensuring efficient f...

HCLTech is seeking an accomplished Network Architect – SME to lead the design, transformation, automation, and governance of secure, scalable network infrastructures across enterprise and industrial environments. The role bridges IT and OT teams wh...

Cape Town, South Africa | Posted on 06/01/2026Are you a registered Industrial Psychologist or Psychometrist who enjoys the challenge of working where science meets business, partnering with clients, shaping evidence-based talent solutions, and helpin...

Reference: ITE005618-DAP-1Are you ready to embark on your career in the dynamic world of Telecommunications? Our client is looking for a highly motivated and talented individual to join their team as a Junior IT Technical Engineer. As a foundational ...

CXG is a global customer experience agency servicing premium and luxury brands. It helps brands reach profitable growth by turning transactional moments into relationships and emotional experiences.With a network of 170+ customer experience experts a...

A leading tech company based in Cape Town, South Africa is looking for a Cloud Security Engineer to manage security systems and tools related to cloud technologies. This role involves analyzing existing cloud structures, creating new security methods...

JOB PURPOSESourcefin, a leading South African fintech, is seeking a commercially sharp and detail-oriented Construction Quantity Surveyor to join our Construction Team. In this role, you will assess, track and report on the financial and commercial p...

A recruitment firm in South Africa is looking for a Procurement Coordinator to handle sales orders and supplier interactions. The role requires a minimum of 2-3 years in Procurement or Logistics Coordinating. The ideal candidate should have strong co...

Role Summaryiqbusiness is seeking experienced Senior Business Analysts for contract opportunities within the financial services sector, with strong hands‑on experience delivering asset management projects.This role is suited to Business Analysts wi...

The Building Company in Fish Hoek is seeking a Cashier Supervisor to direct and support the cashier team, ensuring smooth payment processing and accurate banking reconciliation. You will guide staff, assist with authorisations and customer service, a...

A reputable recruitment agency is seeking a Detail Representative in Cape Town, responsible for extensive travel and educating doctors on specific products. Candidates must hold a Bachelor's degree in a medical field and possess strong computer liter...

Job descriptionWe are currently looking for a senior PHP web developer to help us continue to build our products and services. Together with a team of young, enthusiastic creatives and developers, you will develop new tools, maintain and expand exist...

Internship Programme OverviewThe Free State Office of the Premier invites unemployed South African graduates residing in Bloemfontein to apply for the Graduate Internship Programme 2026. Internship Application Closing Date: 04 August 2026 Internship ...

IntroductionAs an Embedded Firmware Engineer, you will deliver new secure applications for a variety of product variants. You will be responsible for the design and development of new applications, enhancing existing applications, solving problems, a...

A marketing services company in Johannesburg is seeking a Client Success Director to engage with customers, understand their strategic drivers, and develop plans that ensure sustainable growth and profitability. The ideal candidate will have a Bachel...

Ausbildung Kaufmann/-frau für Digitalisierungsmanagement (w/m/d) - ab Sept. 2027Wir gestalten die Energiewende im Herzen des Ruhrgebiets. Die Stadtwerke Bochum Holding GmbH bündelt alle kaufmännischen, technischen und rechtlichen Querschnittsfunkt...

OverviewAre you passionate about data, eager to grow, and excited by the idea of shaping insights that power world‑class gaming experiences? Join our Central Intelligence Solutions team as a Data Scientist and help build the future of data‑driven...

Company DescriptionWNS Global Services Inc. (NYSE: WNS) is a global Business Process Management (BPM) leader. WNS offers business value to 400+ global clients by combining operational excellence with deep domain expertise in key industry verticals, i...

A technology solutions provider seeks a skilled developer with expertise in NATURAL/ADABAS and experience across all phases of systems development. You will maintain existing systems, develop new applications, and ensure standards adherence. Required...

Macsteel Service Centres SA (Pty) Ltd in South Africa seeks a skilled accountant to join the finance team in Gauteng. The role covers forecasting, journal entries, reconciliations, financial reporting and annual budgets, requiring both independent wo...

A leading supplier of industrial connectivity, cables, and automation solutions is looking for a driven Customer Acquisition Manager to identify new business opportunities and expand its customer base.This role is ideal for a proactive sales professi...

Main purpose of the position Currently we are looking for a Junior Systems Analyst -Supply Chain in Cape Town, South Africa to be part of our global team working together towards our vision – Improving our future. As our ...

Mediclinic Southern Africa Corporate Office Welkom invites applications for a Radiographer to join our radiology team. The role involves operating X-ray equipment, CT, and MRI to produce high-quality diagnostic images.You will assist the Radiologist ...

Creative Content Producer (Junior to Mid-Level)Sandton, South Africa | Posted on 21/05/2026Firewater is looking for a highly motivated Junior to Mid-Level Creative Content Producer to join our growing team. This role is ideal for someone who lives an...

Key ResponsibilitiesGreet customers warmly and assist with banking transactions professionally.Process banking transactions accurately, complying with regulatory standards.Perform cleaning duties to maintain a safe and inviting branch environment.Res...

RESPONSBILITIES:Loading and off-loading goods from vehicle at depotOff-loading goods from vehicle at client’s premisesStacking of goods from vehicle into designated areaEnsuring that the goods are loaded correctly and secure on the vehicle at all t...

PurposeThe position demands meticulous attention to detail and a profound comprehension of how interactions with stakeholders can shape outcomes. Strong communication skills are essential, alongside the ability to swiftly devise alternative plans whe...

Embark on a rewarding career journey with a prestigious Financial Services company. Our client is currently seeking a SAIPA Tax Administrator to join their renowned industry.Responsibilities:Effective organization of daily tasks (Time management, pla...

A leading consulting firm is seeking a knowledgeable professional to deliver CF & LCA consulting projects with a focus on sustainability in Stellenbosch. The successful candidate will manage client engagement and develop calculation tools while demon...

We are looking for a highly organized and customer-focused Stops Compliance Agent to join our Customs team. Responsible for liaison with Customs authorities and Other Government Authorities (OGA) for processing of any additional paperwork, thus ensur...

OverviewTo call on clients in and around the assigned area. Build, maintain relationships, promote and sell the full range of our products.Key ResponsibilitiesPlan calls and call frequenciesCall and follow up on customersDo quotationsInvoice customer...

A position has arisen in our KZN branch for a Key Accounts Manager. The successful applicant will report to the Sales Executive for the companyDuties and responsibilities:Day-to-day calling on customers and management of identified key accountsDay-to...

The Purpose Of The Role The senior manager is responsible for conducting and managing investigations and preparing concise and quality forensic reports on client matters, projects and practice management, including billing and recoveries, directing a...

OverviewOur Client is a high-end, boutique catering company known for exceptional quality, personalized service, and event excellence. We are seeking a seasoned Head Chef with a strong culinary and catering background, excellent knowledge of catering...

OttoBauthentic in Johannesburg is seeking a Compliance Officer for Security. The role is to ensure compliance with aviation regulations and manage security service providers effectively. Applicants should possess a Diploma or Degree in Security Manag...

Job Title: Tower Assembly and Erection Site SupervisorsTo provide site contract management service to the Project Manager for all site-related tasks allocated for the construction of Medupi Witkop 400kV Line Section(s) A, B, C & D.Required Equipment:...

ThispositionisforaSeniorLegalAdvisorwithinalistedcompanyinthefinancialservicesindustry(corporate,LISP,retirementfunds,collectiveinvestmentschemes,LinkedLifelicense,assetmanagement,retailandinstitutionalinvestmentproducts).Thisisanexcellentopportunity...

Hire Resolve's Client is looking for ambitious, consultative Development Sales Consultants for a premium property development in KwaZulu-Natal. Candidates should be passionate about property and luxury sales, capable of inspiring buyers and building ...

Opportunities, 26 June 2020Getting your Trinity Audio player ready...BioInnovate Africa is a regional biosciences research and innovation initiative established in 2010 with support from the Swedish International Development Cooperation Agency (Sida)...

Job Advert Summary The purpose of this position is to monitor, maintain, and continuously improve the Quality and Food Safety Management System, ensuring compliance with regulatory, customer, and company requirements. The role supports the achievemen...

Location: Pretoria, South Africa | Type: Full-time, Onsite | Duration: 10 months (1 February 2027 – 30 November 2027)Company OverviewSiemens Digital Industries Software is a leading provider of solutions for the design, simulation, and manufacture ...

SCallaghan Recruitment is assisting a well-established logistics and fleet services business in appointing a qualified Diesel Mechanic / Workshop Foreman for its Pinetown operation. This role requires hands-on leadership in a busy workshop environmen...

About the job HUMAN RESOURCES & IR MANAGERROLE DESCRIPTION:The role drives an employee-orientated culture with emphases on quality internal services, employee development and retention, and continuous improvement. The role serves as a senior support ...

What we are looking forAn energetic sales and marketing professional with the ability to apply superior communication and persuasion skills, and sales knowledge to expand market share.Duties & ResponsibilitiesSALESMeet monthly sales targets according...

HR Business Partner/ HR Operations ManagerReference: JHB006053-LM-1Accelerate your learning curve in this world-class, multi-brand distributor of electronic security solutions!Duties & ResponsibilitiesBe part of a winning team in a highly competitive...

Assistant Manager – Internal Audit and IT AuditPosition OverviewThe Internal/IT Audit Manager will act as a level of support to the Associate Director by providing operational support on effective planning, execution, and delivery of internal and I...

The Apex Group was established in Bermuda in 2003 and is now one of the world’s largest fund administration and middle office solutions providers. Our business is unique in its ability to reach globally, service locally and provide cross‑jurisdic...